Skip to Content

ELISA Recombinant Interleukin-3 receptor subunit alpha(IL3RA)

https://www.paratuberculosis.info/web/image/product.template/134316/image_1920?unique=706639d
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:P26951 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:TKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAGKAGLEECLVTEVQVVQKT Protein Names:Recommended name: Interleukin-3 receptor subunit alpha Short name= IL-3 receptor subunit alpha Short name= IL-3R subunit alpha Short name= IL-3R-alpha Short name= IL-3RA Alternative name(s): CD_antigen= CD123 Gene Names:Name:IL3RA Synonyms:IL3R Expression Region:19-378 Sequence Info:fµLl length protein

1,715.00 € 1715.0 EUR 1,715.00 €

1,715.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF011658HU