ELISA Recombinant Interferon-induced transmembrane protein 5(IFITM5)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:A6NNB3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDTAYPREDTRAPTPSKAGAHTALTLGAPHPPPRDHLIWSVFSTLYLNLCCLGFLALAYS IKARDQKVVGDLEAARRFGSKAKCYNILAAMWTLVPPLLLLGLVVTGALHLARLAKDSAA FFSTKFDDADYD Protein Names:Recommended name: Interferon-induced transmembrane protein 5 Alternative name(s): Bone-restricted interferon-induced transmembrane protein-like protein Short name= BRIL Gene Names:Name:IFITM5 Expression Region:1-132 Sequence Info:FµLl length protein