ELISA Recombinant Hyaluronan synthase 3(HAS3)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Gallus gallus (Chicken) Uniprot NO.:O57425 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:SYFGCVQCISGPLGMYRNTLLQQFLEDWYHQTFLGTKCSFGDDRHLTNRVLSLGYQTKYT PRSRCLTETPTRYLRWLNQQTRWSKSYFREWLYNALWFHKHHLWMTYESVVTGFFPFFLI ATVIQLFYRGRIWNILLFLLTVQLVGIIKATYACFLRGSAEMIFVSLYALLYMSSLLPAK MFAIATINKS Protein Names:Recommended name: Hyaluronan synthase 3 EC= 2.4.1.212 Alternative name(s): Hyaluronate synthase 3 Hyaluronic acid synthase 3 Short name= CHAS3 Short name= HA synthase 3 Gene Names:Name:HAS3 Expression Region:1-190 Sequence Info:FµLl length protein