Skip to Content

ELISA Recombinant Integral membrane protein GPR137B(GPR137B)

https://www.paratuberculosis.info/web/image/product.template/134171/image_1920?unique=3f1195a
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:O60478 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MRPERPRPRGSAPGPMETPPWDPARNDSLPPTLTPAVPPYVKLGLTVVYTVFYALLFVFI YVQLWLVLRYRHKRLSYQSVFLFLCLFWASLRTVLFSFYFKDFVAANSLSPFVFWLLYCF PVCLQFFTLTLMNLYFTQVIFKAKSKYSPELLKYRLPLYLASLFISLVFLLVNLTCAVLV KTGNWERKVIVSVRVAINDTLFVLCAVSLSICLYKISKMSLANIYLESKGSSVCQVTAIG VTVILLYTSRACYNLFILSFSQNKSVHSFDYDWYNVSDQADLKNQLGDAGYVLFGVVLFV WELLPTTLVVYFFRVRNPTKDLTNPGMVPSHGFSPRSYFFDNPRRYDSDDDLAWNIAPQG LQGGFAPDYYDWGQQTNSFLAQAGTLQDSTLDPDKPSLG Protein Names:Recommended name: Integral membrane protein GPR137B Alternative name(s): Transmembrane 7 superfamily member 1 protein Gene Names:Name:GPR137B Synonyms:TM7SF1 Expression Region:1-399 Sequence Info:FµLl length protein

1,756.00 € 1756.0 EUR 1,756.00 €

1,756.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF009753HU