Skip to Content

ELISA Recombinant Gap junction alpha-8 protein(GJA8)

https://www.paratuberculosis.info/web/image/product.template/133006/image_1920?unique=3f1195a
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:P48165 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:GDWSFLGNILEEVNEHSTVIGRVWLTVLFIFRILILGTAAEFVWGDEQSDFVCNTQQPGC ENVCYDEAFPISHIRLWVLQIIFVSTPSLMYVGHAVHYVRMEEKRKSREAEELGQQAGTN GGPDQGSVKKSSGSKGTKKFRLEGTLLRTYICHIIFKTLFEVGFIVGHYFLYGFRILPLY RCSRWPCPNVVDCFVSRPTEKTIFILFmLSVASVSLFLNVMELGHLGLKGIRSALKRPVE QPLGEIPEKSLHSIAVSSIQKAKGYQLLEEEKIVSHYFPLTEVGMVETSPLPAKPFNQFE EKISTGPLGDLSRGYQETLPSYAQVGAQEVEGEGPPAEEGAEPEVGEKKEEAERLTTEEQ EKVAVPEGEKVETPGVDKEGEKEEPQSEKVSKQGLPAEKTPSLCPELTTDDARPLSRLSK ASSRARSDDLTV Protein Names:Recommended name: Gap junction alpha-8 protein Alternative name(s): Connexin-50 Short name= Cx50 Lens fiber protein MP70 Gene Names:Name:GJA8 Expression Region:2-433 Sequence Info:FµLl length protein

1,791.00 € 1791.0 EUR 1,791.00 €

1,791.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF009449HU