ELISA Recombinant Gap junction alpha-4 protein(GJA4)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:P35212 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:GDWGFLEKLLDQVQEHSTVVGKIWLTVLFIFRILILGLAGESVWGDEQSDFECNTAQPGC TNVCYDQAFPISHIRYWVLQFLFVSTPTLVYLGHVIYLSRREERLRQKEGELRALPAKDP QVERALAAVERQMAKISVAEDGRLRIRGALMGTYVASVLCKSVLEAGFLYGQWRLYGWTM EPVFVCQRAPCPYLVDCFVSRPTEKTIFIIFmLVVGLISLVLNLLELVHLLCRCLSRGMR ARQGQDAPPTQGTSSDPYTDQVFFYLPVGQGPSSPPCPTYNGLSSSEQNWANLTTEERLA SSRPPLFLDPPPQNGQKPPSRPSSSASKKQYV Protein Names:Recommended name: Gap junction alpha-4 protein Alternative name(s): Connexin-37 Short name= Cx37 Gene Names:Name:GJA4 Expression Region:2-333 Sequence Info:FµLl length protein