Skip to Content

ELISA Recombinant Gap junction alpha-1 protein(GJA1)

https://www.paratuberculosis.info/web/image/product.template/121932/image_1920?unique=3f1195a
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Gallus gallus (Chicken) Uniprot NO.:P14154 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:GDWSALGKLLDKVQAYSTAGGKVWLSVLFIFRILLLGTAVESAWGDEQSAFRCNTQQPGC ENVCYDKSFPISHVRFWVLQIIFVSVPTLLYLAHVFYVMRKEEKLNKREEELKVVQNDGV NVDMHLKQIESKKFKYGIEEHGKVKMRGGLLRTYIISILFKSVFEVAFLLIQWYIYGFSL SAIYTCERDPCPHRVDCFLSRPTEKTIFIVFmLVVSLVSLALNIIELFYVFFKGVKDRVK GKTDPYSHSGTMSPSKDCGSPKYAYYNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYN KQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFADEHQNTKKLASGHELQPLTIVDQR PPSRASSRASSRPRPDDLEI Protein Names:Recommended name: Gap junction alpha-1 protein Alternative name(s): Connexin-43 Short name= Cx43 Gene Names:Name:GJA1 Expression Region:2-381 Sequence Info:FµLl length protein

1,736.00 € 1736.0 EUR 1,736.00 €

1,736.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF009443CH