ELISA Recombinant N-formyl peptide receptor 2(FPR2)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:P25090 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVT TICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIA LDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNF ASWGGTPEERLKVAITmLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPL RVLTAVVASFFICWFPFQLVALLGTVWLKEmLFYGKYKIIDILVNPTSSLAFFNSCLNPM LYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM Protein Names:Recommended name: N-formyl peptide receptor 2 Alternative name(s): FmLP-related receptor I Short name= FmLP-R-I Formyl peptide receptor-like 1 HM63 Lipoxin A4 receptor Short name= LXA4 receptor RFP Gene Names:Name:FPR2 Synonyms:FPRH1, FPRL1, LXA4R Expression Region:1-351 Sequence Info:FµLl length protein