ELISA Recombinant Low affinity immunoglobulin gamma Fc region receptor II-b(FCGR2B)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:P31994 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:TPAAPPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAPSSSPMGIIVAVVTGIAVAAIVAAVVALIYCRKKRISALPGYPECREMGETLPEKPANPTNPDEADKVGAENTITYSLLMHPDALEEPDDQNRI Protein Names:Recommended name: Low affinity immunoglobµLin gamma Fc region receptor II-b Short name= IgG Fc receptor II-b Alternative name(s): CDw32 Fc-gamma RII-b Short name= Fc-gamma-RIIb Short name= FcRII-b CD_antigen= CD32 Gene Names:Name:FCGR2B Synonyms:CD32, FCG2, IGFR2 Expression Region:43-310 Sequence Info:fµLl length protein