Skip to Content

ELISA Recombinant Neuronal acetylcholine receptor subunit beta-2(CHRNB2)

https://www.paratuberculosis.info/web/image/product.template/121995/image_1920?unique=706639d
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Gallus gallus (Chicken) Uniprot NO.:P09484 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:TDTEERLVEYLLDPTRYNKLIRPATNGSQLVTVQLMVSLAQLISVHEREQIMTTNVWLTQ EWEDYRLTWKPEDFDNMKKVRLPSKHIWLPDVVLYNNADGMYEVSFYSNAVISYDGSIFW LPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVLKSEVASLDDFTPSGEWDI VALPGRRNENPDDSTYVDITYDFIIRRKPLFYTINLIIPCILITSLAILVFYLPSDCGEK MTLCISVLLALTVFLLLISKIVPPTSLDVPLVGKYLMFTMVLVTFSIVTSVCVLNVHHRS PTTHTMPPWVRTLFLRKLPALLFMKQPQQNCARQRLRQRRQTQERAAAATLFLRAGARAC ACYANPGAAKAEGLNGYRERQGQGPDPPAPCGCGLEEAVEGVRFIADHMRSEDDDQSVSE DWKYVAMVIDRLFLWIFVFVCVFGTVGMFLQPLFQNYATNSLLQLGQGTPTSK Protein Names:Recommended name: Neuronal acetylcholine receptor subunit beta-2 Alternative name(s): Neuronal acetylcholine receptor non-alpha-1 chain Short name= N-alpha 1 Gene Names:Name:CHRNB2 Expression Region:19-491 Sequence Info:FµLl length protein

1,834.00 € 1834.0 EUR 1,834.00 €

1,834.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF005396CH