ELISA Recombinant Hematopoietic progenitor cell antigen CD34(CD34)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Homo sapiens ()
Uniprot NO.:P28906
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:SLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKTLIALVTSGALLAVLGITGYFLMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGTSPEAQGKASVNRGAQENGTGQATSRNGHSARQHVVADTEL
Protein Names:Recommended name: Hematopoietic progenitor cell antigen CD34 Alternative name(s): CD_antigen= CD34
Gene Names:Name:CD34
Expression Region:32-385
Sequence Info:fµLl length protein
Internal Reference:
CSB-CF004926HU