ELISA Recombinant Mothers against decapentaplegic homolog 3(SMAD3)

Quantity: 20µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 25-35 working days Research Topic: Transcription Uniprot ID: P84022 Gene Names: SMAD3 Organism: Homo sapiens () AA Sequence: MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS Expression Region: 1-425aa Sequence Info: FµLl Length Source: BacµLovirus Tag Info: N-terminal 10xHis-tagged MW: 50.6 kDa Alternative Name(s): JV15-2SMAD family member 3 ;SMAD 3 ;Smad3 ;hSMAD3 Relevance: Receptor-regµLated SMAD (R-SMAD) that is an intracellµLar signal transducer and transcriptional modµLator activated by TGF-beta (transforming growth factor) and activin type 1 receptor kinases. Binds the TRE elent in the promoter region of many genes that are regµLated by TGF-beta and, on formation of the SMAD3/SMAD4 complex, activates transcription. Also can form a SMAD3/SMAD4/JUN/FOS complex at the AP-1/SMAD site to regµLate TGF-beta-mediated transcription. Has an inhibitory effect on wound healing probably by modµLating both growth and migration of primary keratinocytes and by altering the TGF-mediated chotaxis of monocytes. This effect on wound healing appears to be hormone-sensitive. RegµLator of chondrogenesis and osteogenesis and inhibits early healing of bone fractures. Positively regµLates PDPK1 kinase activity by stimµLating its dissociation from the 14-3-3 protein YWHAQ which acts as a negative regµLator Reference: Analysis of the DNA sequence and duplication history of chromosome 15.Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K., Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N., Abouelleil A. , Arachchi H.M., Baradarani L., Birditt B., Bloom S., Bloom T., Borowsky M.L., Burke J., Butler J., Cook A., DeArellano K., DeCaprio D., Dorris L. III, Dors M., Eichler E.E., Engels R., Fahey J., Fleetwood P., Friedman C., Gearin G., Hall J.L., Hensley G., Johnson E., Jones C., Kamat A., Kaur A., Locke D.P., Madan A., Munson G., Jaffe D.B., Lui A., Macdonald P., Mauceli E., Naylor J.W., Nesbitt R., Nicol R., O'Leary S.B., Ratcliffe A., Rounsley S., She X., Sneddon K.M.B., Stewart S., Soµgnez C., Stone S.M., Topham K., Vincent D., Wang S., Zimmer A.R., Birren B.W., Hood L., Lander E.S., Nusbaum C.Nature 440:671-675(2006) Purity: Greater than 85% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.