Se rendre au contenu

ELISA Recombinant Heat shock factor-binding protein 1(HSBP1),partial

https://www.paratuberculosis.info/web/image/product.template/133493/image_1920?unique=3f1195a
Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Epigenetics and Nuclear Signaling Uniprot ID: O75506 Gene Names: HSBP1 Organism: Homo sapiens () AA Sequence: MAETDPKTVQDLTSVVQTLLQQMQDKFQTMSDQIIGRIDDMSSRIDDLEKNIADLMTQAGVEELESENKIPATQK Expression Region: 1-75aa Sequence Info: Partial Source: E.coli Tag Info: N-terminal GST-tagged MW: 35.5 kDa Alternative Name(s): Nasopharyngeal carcinoma-associated antigen 13 ;NPC-A-13 Relevance: Negative regµLator of the heat shock response. Negatively affects HSF1 DNA-binding activity. May have a role in the suppression of the activation of the stress response during the aging process. Reference: A quantitative atlas of mitotic phosphorylation.Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer,50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

709,00 € 709.0 EUR 709,00 €

709,00 €

Not Available For Sale

Cette combinaison n'existe pas.

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables


Référence interne: CSB-RP004544h