Se rendre au contenu

ELISA Recombinant Mitochondrial import receptor subunit TOM34(TOMM34)

https://www.paratuberculosis.info/web/image/product.template/135359/image_1920?unique=706639d
Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Signal Transduction Uniprot ID: Q15785 Gene Names: TOMM34 Organism: Homo sapiens () AA Sequence: MAPKFPDSVEELRAAGNESFRNGQYAEASALYGRALRVLQAQGSSDPEEESVLYSNRAACHLKDGNCRDCIKDCTSALALVPFSIKPLLRRASAYEALEKYPMAYVDYKTVLQIDDNVTSAVEGINRMTRALMDSLGPEWRLKLPSIPLVPVSAQKRWNSLPSENHKEMAKSKSKETTATKNRVPSAGDVEKARVLKEEGNELVKKGNHKKAIEKYSESLLCSNLESATYSNRALCYLVLKQYTEAVKDCTEALKLDGKNVKAFYRRAQAHKALKDYKSSFADISNLLQIEPRNGPAQKLRQEVKQNLH Expression Region: 1-309aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal GST-tagged MW: 61.6 kDa Alternative Name(s): Translocase of outer membrane 34KDA subunit Relevance: Plays a role in the import of cytosolically syntheQuantityd preproteins into mitochondria. Binds the mature portion of precursor proteins. Interacts with cellµLar components, and possesses weak ATPase activity. May be a chaperone-like protein that helps to keep newly syntheQuantityd precursors in an unfolded import compatible state. Reference: "hTom34: a novel translocase for the import of proteins into mitochondria." Nuttall S.D., Hanson B.J., Mori M., Hoogenraad N.J. DNA Cell Biol. 16:1067-1074(1997) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer,50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

709,00 € 709.0 EUR 709,00 €

709,00 €

Not Available For Sale

Cette combinaison n'existe pas.

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables


Référence interne: CSB-EP623014HU