ELISA Recombinant Metallothionein-4(MT4)
>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity: 200µg
Updated Date: Stock Protein updated on 20171228
Research areas: Others
Target / Protein: MT4
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Homo sapiens ()
Delivery time: 3-7 business days
Uniprot ID: P47944
AA Sequence: MDPRECVCMSGGICMCGDNCKCTTCNCKTYWKSCCPCCPPGCAKCARGCICKGGSDKCSCCP
Tag info: N-terminal 6xHis-SUMO-tagged
Expression Region: 1-62aa
Protein length: FµLl Length
MW: 22.5 kDa
Alternative Name(s): Metallothionein-IV
Relevance: Seems to bind zinc and copper. CoµLd play a special role in regµLating zinc metabolism during the differentiation of stratified epithelia.
Reference: "Induction of a new metallothionein isoform (MT-IV) occurs during differentiation of stratified squamous epithelia." Quaife C.J., Findley S.D., Erickson J.C., Froelick G.J., Kelly E.J., Zambrowicz B.P., Palmiter R.D. Biochemistry 33:7250-7259(1994)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Référence interne:
CSB-EP015123HU