Se rendre au contenu

ELISA Recombinant Olfactory receptor 10A2(OR10A2)

https://www.paratuberculosis.info/web/image/product.template/136160/image_1920?unique=706639d
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q9H208 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSFSSLPTEIQSLLFLTFLTIYLVTLMGNCLIILVTLADPmLHSPMYFFLRNLSFLEIGF NLVIVPKmLGTLLAQDTTISFLGCATQMYFFFFFGVAECFLLATMAYDRYVAICSPLHYP VIMNQRTRAKLAAASWFPGFPVATVQTTWLFSFPFCGTNKVNHFFCDSPPVLRLVCADTA LFEIYAIVGTILVVMIPCLLILCSYTHIAAAILKIPSAKGKNKAFSTCSSHLLVVSLFYI SLSLTYFRPKSNNSPEGKKLLSLSYTVMTPmLNPIIYSLRNNEVKNALSRTVSKALALRN CIP Protein Names:Recommended name: Olfactory receptor 10A2 Alternative name(s): HP4 Olfactory receptor OR11-86 Gene Names:Name:OR10A2 Synonyms:OR10A2P Expression Region:1-303 Sequence Info:fµLl length protein

1.655,00 € 1655.0 EUR 1.655,00 €

1.655,00 €

Not Available For Sale

Cette combinaison n'existe pas.

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables


Référence interne: CSB-CF884445HU