Se rendre au contenu

ELISA Recombinant Myelin proteolipid protein(PLP1)

https://www.paratuberculosis.info/web/image/product.template/149659/image_1920?unique=706639d
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Sus scrofa (Pig) Uniprot NO.:Q712P7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:GLLECCARCLVGAPFASLVATGLCFFGVALFCGCGHEALTGTEKLIETYFSKNYQDYEYL INVIHAFQYVIYGTASFFFLYGALLLAEGFYTTGAVRQIFGDYKTTICGKGLSATVTGGQ KGRGSRGQHQAHSLERVCHCLGKWLGHPDKFVGITYALTVVWLLVFACSAVPVYIYFNTW TTCQSIAFPSKTSASIGSLCADARMYGVLPWNAFPGKVCGSNLLSICKTAEFQMTFHLFI AAFVGAAATLVSLLTFMIAATYNFAVLKLMGRGTKF Protein Names:Recommended name: Myelin proteolipid protein Short name= PLP Alternative name(s): Lipophilin Gene Names:Name:PLP1 Synonyms:PLP Expression Region:2-277 Sequence Info:fµLl length protein

1.626,00 € 1626.0 EUR 1.626,00 €

1.626,00 €

Not Available For Sale

Cette combinaison n'existe pas.

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables


Référence interne: CSB-CF758249PI