Se rendre au contenu

ELISA Recombinant N-acetylglucosamine-1-phosphotransferase subunits alpha-beta(GNPTAB)

https://www.paratuberculosis.info/web/image/product.template/135676/image_1920?unique=706639d
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q3T906 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:DTFADSLRYVNKILNSKFGFTSRKVPAHMPHMIDRIVMQELQDMFPEEFDKTSFHKVRHS EDMQFAFSYFYYLMSAVQPLNISQVFDEVDTDQSGVLSDREIRTLATRIHELPLSLQDLT GLEHmLINCSKmLPADITQLNNIPPTQESYYDPNLPPVTKSLVTNCKPVTDKIHKAYKDK NKYRFEIMGEEEIAFKMIRTNVSHVVGQLDDIRKNPRKFVCLNDNIDHNHKDAQTVKAVL RDFYESMFPIPSQFELPREYRNRFLHMHELQEWRAYRDKLKFWTHCVLATLIMFTIFSFF AEQLIALKRKIFPRRRIHKEASPNRIRV Protein Names:Recommended name: N-acetylglucosamine-1-phosphotransferase subunits alpha/beta EC= 2.7.8.17 Alternative name(s): GlcNAc-1-phosphotransferase subunits alpha/beta Stealth protein GNPTAB UDP-N-acetylglucosamine-1-phosphotransferase sub Gene Names:Name:GNPTAB Synonyms:GNPTA, KIAA1208 Expression Region:929-1256 Sequence Info:fµLl length protein

1.681,00 € 1681.0 EUR 1.681,00 €

1.681,00 €

Not Available For Sale

Cette combinaison n'existe pas.

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables


Référence interne: CSB-CF666221HU