Se rendre au contenu

ELISA Recombinant Opalin(OPALIN)

https://www.paratuberculosis.info/web/image/product.template/149672/image_1920?unique=f2aba11
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Sus scrofa (Pig) Uniprot NO.:Q29102 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSFSLNFTLPANTTSSPVVTSGKGADCGPSLGLAAGIPSLVATALLVALLLILIHRRRRS SESTEEIERPCEISEIYDNPRVAENPRRSPTHEKNIMGAEEAHIYVKTVSGSQEPMRDTY RPAVEMERRRGLWWLIPRLSLE Protein Names:Recommended name: Opalin Alternative name(s): Oligodendrocytic myelin paranodal and inner loop protein Transmembrane protein 10 Transmembrane protein sp83.5 Gene Names:Name:OPALIN Synonyms:SP83.5, TMEM10 Expression Region:1-142 Sequence Info:fµLl length protein

1.485,00 € 1485.0 EUR 1.485,00 €

1.485,00 €

Not Available For Sale

Cette combinaison n'existe pas.

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables


Référence interne: CSB-CF645836PI