Se rendre au contenu

ELISA Recombinant Olfactory receptor-like protein COR2(COR2)

https://www.paratuberculosis.info/web/image/product.template/121846/image_1920?unique=f2aba11
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Gallus gallus (Chicken) Uniprot NO.:P37068 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MASGNCTTPTTFILSGLTDNPRLQMPLFMVFLVIYTTTLLTNLGLIALIGMDLHLQTPMY IFLQNLSFTDAAYSTVITPKmLATFLEERRTISYVGCILQYFSFVLLTTSEWLLLAVMAY DRYVAICKPLLYPSIMTKAVCWRLVKGLYSLAFLNSLVHTSGLLKLSFCSSNVVNHFFCD NRPLFQISSSSTTLNELLVIISGSLFVMSSIITILISYVFIILTVVMIRSKDGKYKAFST CTSHLMAVSLFHGTVIFMYLRSVKLFSLDTDKIASLFYTVVIPmLNPLIYSWRNKEVKDA LRRLTATSVWLH Protein Names:Recommended name: Olfactory receptor-like protein COR2 Gene Names:Name:COR2 Expression Region:1-312 Sequence Info:fµLl length protein

1.664,00 € 1664.0 EUR 1.664,00 €

1.664,00 €

Not Available For Sale

Cette combinaison n'existe pas.

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables


Référence interne: CSB-CF336252CH