Se rendre au contenu

ELISA Recombinant Olfactory receptor 6A2(OR6A2)

https://www.paratuberculosis.info/web/image/product.template/136473/image_1920?unique=f2aba11
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:O95222 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MEWRNHSGRVSEFVLLGFPAPAPLQVLLFALLLLAYVLVLTENTLIIMAIRNHSTLHKPM YFFLANMSFLEIWYVTVTIPKmLAGFVGSKQDHGQLISFEGCMTQLYFFLGLGCTECVLL AVMAYDRYMAICYPLHYPVIVSGRLCVQMAAGSWAGGFGISMVKVFLISGLSYCGPNIIN HFFCDVSPLLNLSCTDMSTAELTDFILAIFILLGPLSVTGASYVAITGAVMHIPSAAGRY KAFSTCASHLTVVIIFYAASIFIYARPKALSAFDTNKLVSVLYAVIVPLLNPIIYCLRNQ EVKRALCCTLHLYQHQDPDPKKASRNV Protein Names:Recommended name: Olfactory receptor 6A2 Alternative name(s): Olfactory receptor 11-55 Short name= OR11-55 Olfactory receptor 6A1 Olfactory receptor OR11-83 hP2 olfactory receptor Gene Names:Name:OR6A2 Synonyms:OR6A1, OR6A2P Expression Region:1-327 Sequence Info:FµLl length protein

1.680,00 € 1680.0 EUR 1.680,00 €

1.680,00 €

Not Available For Sale

Cette combinaison n'existe pas.

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables


Référence interne: CSB-CF016993HU