Se rendre au contenu

ELISA Recombinant Microsomal glutathione S-transferase 1(MGST1)

https://www.paratuberculosis.info/web/image/product.template/135305/image_1920?unique=706639d
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:P10620 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:VDLTQVMDDEVFMAFASYATIILSKMmLMSTATAFYRLTRKVFANPEDCVAFGKGENAKK YLRTDDRVERVRRAHLNDLENIIPFLGIGLLYSLSGPDPSTAILHFRLFVGARIYHTIAY LTPLPQPNRALSFFVGYGVTLSMAYRLLKSKLYL Protein Names:Recommended name: Microsomal glutathione S-transferase 1 Short name= Microsomal GST-1 EC= 2.5.1.18 Alternative name(s): Microsomal GST-I Gene Names:Name:MGST1 Synonyms:GST12, MGST Expression Region:2-155 Sequence Info:FµLl length protein

1.498,00 € 1498.0 EUR 1.498,00 €

1.498,00 €

Not Available For Sale

Cette combinaison n'existe pas.

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables


Référence interne: CSB-CF013791HU