Se rendre au contenu

ELISA Recombinant Leptin receptor gene-related protein(LEPROT)

https://www.paratuberculosis.info/web/image/product.template/134708/image_1920?unique=706639d
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:O15243 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAGVKALVALSFSGAIGLTFLmLGCALEDYGVYWPLFVLIFHAISPIPHFIAKRVTYDSD ATSSACRELAYFFTTGIVVSAFGFPVILARVAVIKWGACGLVLAGNAVIFLTIQGFFLIF GRGDDFSWEQW Protein Names:Recommended name: Leptin receptor gene-related protein Alternative name(s): Leptin receptor overlapping transcript protein OB-R gene-related protein Short name= OB-RGRP Gene Names:Name:LEPROT Synonyms:LEPR, OBR Expression Region:1-131 Sequence Info:FµLl length protein

1.473,00 € 1473.0 EUR 1.473,00 €

1.473,00 €

Not Available For Sale

Cette combinaison n'existe pas.

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables


Référence interne: CSB-CF012875HU