ELISA Recombinant Leptin receptor gene-related protein(LEPROT)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Homo sapiens ()
Uniprot NO.:O15243
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAGVKALVALSFSGAIGLTFLmLGCALEDYGVYWPLFVLIFHAISPIPHFIAKRVTYDSD ATSSACRELAYFFTTGIVVSAFGFPVILARVAVIKWGACGLVLAGNAVIFLTIQGFFLIF GRGDDFSWEQW
Protein Names:Recommended name: Leptin receptor gene-related protein Alternative name(s): Leptin receptor overlapping transcript protein OB-R gene-related protein Short name= OB-RGRP
Gene Names:Name:LEPROT Synonyms:LEPR, OBR
Expression Region:1-131
Sequence Info:FµLl length protein
Référence interne:
CSB-CF012875HU