ELISA Recombinant Caenorhabditis briggsae Golgi SNAP receptor complex member 1(gos-28)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Caenorhabditis briggsae Uniprot NO.:A8XLW0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSETWEALRKKARSTENSIDVKLVSLNKLTASSHGGFDIDEKTVSSRQTTFRTVTTEIEGLIEQLTNINDDMNDVAGAQSSASWASNPAIQHTLRRHREILRDYGSEYRRARDNVDQVLQRELLLSSSNNESRNPAVNNRARGYDMYLKENDHINACDRLLDEQIEMAMSTKENVARQGINLRGISNRLHYITKKYPAINNLMQKIKTKKQKNTMILAGVISACLIFTIFWIIN Protein Names:Recommended name: Golgi SNAP receptor complex member 1 Alternative name(s): 28 kDa Golgi SNARE protein Short name= GOS-28 Gene Names:Name:gos-28 Synonyms:gosr-1, gs28 ORF Names:CBG15298 Expression Region:1-234 Sequence Info:fµLl length protein