Se rendre au contenu

ELISA Recombinant Gonadotropin-releasing hormone receptor(GNRHR)

https://www.paratuberculosis.info/web/image/product.template/133288/image_1920?unique=3f1195a
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:P30968 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKL QKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYL KLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRM IHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFImLICNAKIIFTLTR VLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEmLNRL SDPVNHFFFLFAFLNPCFDPLIYGYFSL Protein Names:Recommended name: Gonadotropin-releasing hormone receptor Short name= GnRH receptor Short name= GnRH-R Gene Names:Name:GNRHR Synonyms:GRHR Expression Region:1-328 Sequence Info:FµLl length protein

1.681,00 € 1681.0 EUR 1.681,00 €

1.681,00 €

Not Available For Sale

Cette combinaison n'existe pas.

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables


Référence interne: CSB-CF009637HU-GB