ELISA Recombinant Low affinity immunoglobulin gamma Fc region receptor II-b(FCGR2B)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Homo sapiens ()
Uniprot NO.:P31994
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:TPAAPPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAPSSSPMGIIVAVVTGIAVAAIVAAVVALIYCRKKRISALPGYPECREMGETLPEKPANPTNPDEADKVGAENTITYSLLMHPDALEEPDDQNRI
Protein Names:Recommended name: Low affinity immunoglobµLin gamma Fc region receptor II-b Short name= IgG Fc receptor II-b Alternative name(s): CDw32 Fc-gamma RII-b Short name= Fc-gamma-RIIb Short name= FcRII-b CD_antigen= CD32
Gene Names:Name:FCGR2B Synonyms:CD32, FCG2, IGFR2
Expression Region:43-310
Sequence Info:fµLl length protein
Référence interne:
CSB-CF008541HU