Se rendre au contenu

ELISA Recombinant Lymphocyte function-associated antigen 3(CD58)

https://www.paratuberculosis.info/web/image/product.template/134895/image_1920?unique=706639d
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:P19256 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:FSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEHYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHRYALIPIPLAVITTCIVLYMNGILKCDRKPDRTNSN Protein Names:Recommended name: Lymphocyte function-associated antigen 3 Short name= Ag3 Alternative name(s): Surface glycoprotein LFA-3 CD_antigen= CD58 Gene Names:Name:CD58 Synonyms:LFA3 Expression Region:29-250 Sequence Info:fµLl length protein

1.569,00 € 1569.0 EUR 1.569,00 €

1.569,00 €

Not Available For Sale

Cette combinaison n'existe pas.

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables


Référence interne: CSB-CF004946HU